PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G228400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 395aa    MW: 42687.1 Da    PI: 9.5384
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G228400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.27.7e-1376118548
                         -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         T +Ed  l + vk+lG + W+ Ia+ ++  R +kqc++rw+++l
  Sevir.3G228400.1.p  76 TLDEDRSLEKHVKKLGEKKWSMIAKNLP-DRIGKQCRERWLNHL 118
                         789*************************.*************97 PP

2Myb_DNA-binding44.73e-14126167345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +WT+ E++ +v +++++G++ W++ a++++  R+++++k++w+
  Sevir.3G228400.1.p 126 AWTEKEEKVIVALHRKHGNK-WAKMAKRIPGVRSDNSIKNHWN 167
                         8*******************.*********77**********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.25467118IPR017930Myb domain
SMARTSM007178.4E-1071120IPR001005SANT/Myb domain
CDDcd001671.69E-1276118No hitNo description
SuperFamilySSF466891.01E-2276166IPR009057Homeodomain-like
PfamPF139218.0E-1377132No hitNo description
Gene3DG3DSA:1.10.10.603.6E-2177125IPR009057Homeodomain-like
PROSITE profilePS5129421.215119174IPR017930Myb domain
SMARTSM007173.1E-11123172IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-18126169IPR009057Homeodomain-like
CDDcd001671.08E-10126167No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSILLGKTMS RKMARFRNKM LPIFRVPAAD GGLGYGGAIC GNHALLGNTV PSENTLVSQV  60
NAEEDARTYN QRGQRTLDED RSLEKHVKKL GEKKWSMIAK NLPDRIGKQC RERWLNHLSP  120
DIKTTAWTEK EEKVIVALHR KHGNKWAKMA KRIPGVRSDN SIKNHWNATR RWLEAKCRSK  180
TIETAAVRKA TLSMVLELYI RELRDNGKLK VAGAPASAAA DPSMLDDDAA SASWQADDNP  240
AVAEPSSVVA AHAVRRHAAS LPPPMMEAPE PTQDHVYATY DADGYVRYVH LQPTPGHSSA  300
PVNQAAAATA AGYYNPLLFP YYPFGGQQVY GHATCPAGSY YQEAGPSHRY INSGAGGDEA  360
HGDAGFDPAA PGLAGMPFSA NAPAGQNQRG GGAI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-34721714102C-Myb DNA-Binding Domain
1msf_C1e-34721714102C-Myb DNA-Binding Domain
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2759645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.14e-38myb domain protein 98